PDB entry 1xr1

View 1xr1 on RCSB PDB site
Description: Crystal structure of hPim-1 kinase in complex with AMP-PNP at 2.1 A Resolution
Class: transferase
Keywords: protein kinase fold
Deposited on 2004-10-13, released 2004-11-09
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.267
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: HOMO SAPIENS
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xr1a_
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xr1A (A:)
    aapcndlhatklapgkekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdr
    isdwgelpngtrvpmevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfi
    tergalqeelarsffwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgall
    kdtvytdfdgtrvysppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqv
    ffrqrvssecqhlirwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xr1A (A:)
    eplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevv
    llkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqv
    leavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppe
    wiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcl
    alrpsdrptfeeiqnhpwmqdvllpqetaeihlhsls