PDB entry 1xqz

View 1xqz on RCSB PDB site
Description: Crystal Structure of hPim-1 kinase at 2.1 A resolution
Class: transferase
Keywords: protein kinase fold, TRANSFERASE
Deposited on 2004-10-13, released 2004-11-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.249
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xqza_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xqzA (A:)
    aapcndlhatklapgkekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdr
    isdwgelpngtrvpmevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfi
    tergalqeelarsffwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgall
    kdtvytdfdgtrvysppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqv
    ffrqrvssecqhlirwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqzA (A:)
    eplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevv
    llkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqv
    leavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppe
    wiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcl
    alrpsdrptfeeiqnhpwmqdvllpqetaeihlhsls