PDB entry 1xqy

View 1xqy on RCSB PDB site
Description: crystal structure of f1-mutant s105a complex with pro-leu-gly-gly
Deposited on 2004-10-13, released 2005-07-12
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.268
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline iminopeptidase
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: TA0830
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96084 (Start-292)
      • engineered (104)
  • Chain 'Q':
    Compound: plgg
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XQY (0-3)
  • Heterogens: PRO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xqyA (A:)
    mdqecienyakvngiyiyyklckapeekaklmtmhggpgmshdyllslrdmtkegitvlf
    ydqfgcgrseepdqskftidygveeaealrsklfgnekvflmgsayggalalayavkyqd
    hlkglivsgglssvpltvkemnrlidelpakyrdaikkygssgsyenpeyqeavnyfyhq
    hllrsedwppevlksleyaerrnvyrimngpneftitgtikdwditdkisaikiptlitv
    geydevtpnvarvihekiagselhvfrdcshltmwedregynkllsdfilkhl
    

    Sequence, based on observed residues (ATOM records):
    >1xqyA (A:)
    ecienyakvngiyiyyklckapeekaklmtmhggpgmshdyllslrdmtkegitvlfydq
    fgcgrseepdqskftidygveeaealrsklfgnekvflmgsayggalalayavkyqdhlk
    glivsgglssvpltvkemnrlidelpakyrdaikkygssgsyenpeyqeavnyfyhqhll
    rsedwppevlksleyaerrnvyrimngpneftitgtikdwditdkisaikiptlitvgey
    devtpnvarvihekiagselhvfrdcshltmwedregynkllsdfilkhl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >1xqyQ (Q:)
    plgg