PDB entry 1xqu

View 1xqu on RCSB PDB site
Description: hit family hydrolase from clostridium thermocellum cth-393
Deposited on 2004-10-13, released 2004-12-14
Made obsolete by 5uvm on 2017-04-05

The last revision was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIT family hydrolase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00311754
      • modified residue (141)
  • Chain 'B':
    Compound: HIT family hydrolase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00311754 (Start-146)
      • modified residue (141)
  • Heterogens: UNX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xquA (A:)
    mgsshhhhhhssglvprgsqstslykkaglmytlencvfckiikrelpstiyyedervia
    ikdinpaapvhvliipkehianvkeinesnaqilidihkaankvaedlgiaekgyrlitn
    cgvaagqtvfhlhyhllggvdmgpkil
    

    Sequence, based on observed residues (ATOM records):
    >1xquA (A:)
    lencvfckiikrelpstiyyederviaikdinpaapvhvliipkehianvkeinesnaqi
    lidihkaankvaedlgiaekgyrlitncgvaagqtvfhlhyhllggvdmgpki
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1xquB (B:)
    mgsshhhhhhssglvprgsqstslykkaglmytlencvfckiikrelpstiyyedervia
    ikdinpaapvhvliipkehianvkeinesnaqilidihkaankvaedlgiaekgyrlitn
    cgvaagqtvfhlhyhllggvdmgpkil
    

    Sequence, based on observed residues (ATOM records):
    >1xquB (B:)
    lencvfckiikrelpstiyyederviaikdinpaapvhvliipkehianvkeinesnaqi
    lidihkaankvaedlgiaekgyrlitncgvaagqtvfhlhyhllggvdmgpkil