PDB entry 1xqs
View 1xqs on RCSB PDB site
Description: Crystal structure of the HspBP1 core domain complexed with the fragment of Hsp70 ATPase domain
Class: chaperone
Keywords: armadillo repeat, superhelical twist
Deposited on
2004-10-13, released
2005-03-01
The last revision prior to the SCOP 1.75 freeze date was dated
2005-03-01, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.237
AEROSPACI score: 0.25
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: HSPBP1 protein
Species: HOMO SAPIENS
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1xqsa1 - Chain 'B':
Compound: HSPBP1 protein
Species: HOMO SAPIENS
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1xqsb1 - Chain 'C':
Compound: Heat shock 70 kDa protein 1
Species: HOMO SAPIENS
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Heat shock 70 kDa protein 1
Species: HOMO SAPIENS
Database cross-references and differences (RAF-indexed):
- Heterogens: AMP, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1xqsA (A:)
gshmrgqrgeveqmksclrvlsqpmpptageaeqaadqqeregalelladlcenmdnaad
fcqlsgmhllvgryleagaaglrwraaqligtcsqnvaaiqeqvlglgalrkllrlldrd
acdtvrvkalfaisclvreqeagllqflrldgfsvlmramqqqvqklkvksafllqnllv
ghpehkgtlcsmgmvqqlvalvrtehspfhehvlgalcslvtdfpqgvrecrepelglee
llrhrcqllqqheeyqeelefcekllqtcfsspaddsmdr
Sequence, based on observed residues (ATOM records): (download)
>1xqsA (A:)
rgeveqmksclrvlsqpmpptageaeqaadqqeregalelladlcenmdnaadfcqlsgm
hllvgryleagaaglrwraaqligtcsqnvaaiqeqvlglgalrkllrlldrdacdtvrv
kalfaisclvreqeagllqflrldgfsvlmramqqqvqklkvksafllqnllvghpehkg
tlcsmgmvqqlvalvrtehspfhehvlgalcslvtdfpqgvrecrepelgleellrhrcq
llqqheeyqeelefcekllqtcfs
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1xqsB (B:)
gshmrgqrgeveqmksclrvlsqpmpptageaeqaadqqeregalelladlcenmdnaad
fcqlsgmhllvgryleagaaglrwraaqligtcsqnvaaiqeqvlglgalrkllrlldrd
acdtvrvkalfaisclvreqeagllqflrldgfsvlmramqqqvqklkvksafllqnllv
ghpehkgtlcsmgmvqqlvalvrtehspfhehvlgalcslvtdfpqgvrecrepelglee
llrhrcqllqqheeyqeelefcekllqtcfsspaddsmdr
Sequence, based on observed residues (ATOM records): (download)
>1xqsB (B:)
rgeveqmksclrvlsqpmpptageaeqaadqqeregalelladlcenmdnaadfcqlsgm
hllvgryleagaaglrwraaqligtcsqnvaaiqeqvlglgalrkllrlldrdacdtvrv
kalfaisclvreqeagllqflrldgfsvlmramqqqvqklkvksafllqnllvghpehkg
tlcsmgmvqqlvalvrtehspfhehvlgalcslvtdfpqgvrecrepelgleellrhrcq
llqqheeyqeelefcekllqtcfs
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.