PDB entry 1xqp

View 1xqp on RCSB PDB site
Description: Crystal structure of 8-oxoguanosine complexed Pa-AGOG, 8-oxoguanine DNA glycosylase from Pyrobaculum aerophilum
Class: lyase
Keywords: Helix-hairpin-Helix, 8-oxoguanine DNA glycosylase, Archaea, P.aerophilum, Pa-AGOG-8-oxoguanosine complex, DNA repair, LYASE
Deposited on 2004-10-13, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-oxoguanine DNA glycosylase
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: Pa-AGOG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xqpa_
  • Heterogens: 8HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xqpA (A:)
    maaesqlkrvietlrrlgieevlklerrdpqyravcnvvkrhgetvgsrlamlnalisyr
    ltgkgeehweyfgkyfsqlevidlcrdflkyietspflkigvearkkralkacdyvpnle
    dlgltlrqlshivgarreqktlvftikilnyaymcsrgvnrvlpfdipipvdyrvarltw
    caglidfppeealrryeavqkiwdavaretgipplhldtllwlagravlygenlhgvpke
    vialfqwrggcrppse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqpA (A:)
    aesqlkrvietlrrlgieevlklerrdpqyravcnvvkrhgetvgsrlamlnalisyrlt
    gkgeehweyfgkyfsqlevidlcrdflkyietspflkigvearkkralkacdyvpnledl
    gltlrqlshivgarreqktlvftikilnyaymcsrgvnrvlpfdipipvdyrvarltwca
    glidfppeealrryeavqkiwdavaretgipplhldtllwlagravlygenlhgvpkevi
    alfqwrggcrpp