PDB entry 1xqo

View 1xqo on RCSB PDB site
Description: Crystal structure of native Pa-AGOG, 8-oxoguanine DNA glycosylase from Pyrobaculum aerophilum
Class: lyase
Keywords: Helix-hairpin-Helix, 8-oxoguanine DNA glycosylase, Archaea, P.aerophilum, Pa-AGOG native, DNA repair
Deposited on 2004-10-13, released 2004-11-16
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: 0.159
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-oxoguanine DNA glycosylase
    Species: Pyrobaculum aerophilum
    Gene: Pa-AGOG
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xqoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xqoA (A:)
    maaesqlkrvietlrrlgieevlklerrdpqyravcnvvkrhgetvgsrlamlnalisyr
    ltgkgeehweyfgkyfsqlevidlcrdflkyietspflkigvearkkralkacdyvpnle
    dlgltlrqlshivgarreqktlvftikilnyaymcsrgvnrvlpfdipipvdyrvarltw
    caglidfppeealrryeavqkiwdavaretgipplhldtllwlagravlygenlhgvpke
    vialfqwrggcrppse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqoA (A:)
    aaesqlkrvietlrrlgieevlklerrdpqyravcnvvkrhgetvgsrlamlnalisyrl
    tgkgeehweyfgkyfsqlevidlcrdflkyietspflkigvearkkralkacdyvpnled
    lgltlrqlshivgarreqktlvftikilnyaymcsrgvnrvlpfdipipvdyrvarltwc
    aglidfppeealrryeavqkiwdavaretgipplhldtllwlagravlygenlhgvpkev
    ialfqwrggcrpp