PDB entry 1xqo

View 1xqo on RCSB PDB site
Description: crystal structure of native pa-agog, 8-oxoguanine dna glycosylase from pyrobaculum aerophilum
Deposited on 2004-10-13, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: 0.159
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xqoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xqoA (A:)
    maaesqlkrvietlrrlgieevlklerrdpqyravcnvvkrhgetvgsrlamlnalisyr
    ltgkgeehweyfgkyfsqlevidlcrdflkyietspflkigvearkkralkacdyvpnle
    dlgltlrqlshivgarreqktlvftikilnyaymcsrgvnrvlpfdipipvdyrvarltw
    caglidfppeealrryeavqkiwdavaretgipplhldtllwlagravlygenlhgvpke
    vialfqwrggcrppse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqoA (A:)
    aaesqlkrvietlrrlgieevlklerrdpqyravcnvvkrhgetvgsrlamlnalisyrl
    tgkgeehweyfgkyfsqlevidlcrdflkyietspflkigvearkkralkacdyvpnled
    lgltlrqlshivgarreqktlvftikilnyaymcsrgvnrvlpfdipipvdyrvarltwc
    aglidfppeealrryeavqkiwdavaretgipplhldtllwlagravlygenlhgvpkev
    ialfqwrggcrpp