PDB entry 1xqn

View 1xqn on RCSB PDB site
Description: The 15k neutron structure of saccharide-free concanavalin A
Class: sugar binding protein
Keywords: concanavalin a, neutron laue diffraction, bound d2o molecules, cryo-temperature
Deposited on 2004-10-13, released 2004-11-02
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: NEUT
Resolution: 2.5 Å
R-factor: 0.266
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: concanavalin a
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xqna_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xqnA (A:)
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan