PDB entry 1xqn

View 1xqn on RCSB PDB site
Description: The 15k neutron structure of saccharide-free concanavalin A
Class: sugar binding protein
Keywords: concanavalin a, neutron laue diffraction, bound d2o molecules, cryo-temperature, sugar binding protein
Deposited on 2004-10-13, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: NEUT
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: concanavalin a
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xqna_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xqnA (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan