PDB entry 1xqm

View 1xqm on RCSB PDB site
Description: Variations on the GFP chromophore scaffold: A fragmented 5-membered heterocycle revealed in the 2.1A crystal structure of a non-fluorescent chromoprotein
Class: luminescent protein
Keywords: luminescent protein
Deposited on 2004-10-13, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kindling fluorescent protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAO43187 (Start-231)
      • chromophore (62)
    Domains in SCOPe 2.07: d1xqma_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xqmA (A:)
    maslltetmpfkttiegtvnghcfkcigkgegnpfegtqemkievieggplpfafhilst
    scmygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdtsldgdclvykvk
    ilgnnfpadgpvmqnkvgrwepgteivyevdgvlrgqslmalkcpggrhltchlhttyrs
    kkpasalkmpgfhfedhrieimeevekgkcykqyeaavgrycdaapsklghn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqmA (A:)
    slltetmpfkttiegtvnghcfkcigkgegnpfegtqemkievieggplpfafhilstsc
    mygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdtsldgdclvykvkil
    gnnfpadgpvmqnkvgrwepgteivyevdgvlrgqslmalkcpggrhltchlhttyrskk
    pasalkmpgfhfedhrieimeevekgkcykqyeaavgrycdaapsklghn