PDB entry 1xqj

View 1xqj on RCSB PDB site
Description: 3.10 A Crystal structure of maspin, space group I 4 2 2
Class: antitumor protein
Keywords: serpin, maspin, tumor suppression, antitumor protein
Deposited on 2004-10-12, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.201
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maspin
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINB5, PI5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36952 (14-388)
      • cloning artifact (11-13)
      • engineered (33)
      • engineered (47)
      • see remark 999 (79)
      • see remark 999 (189)
      • engineered (196)
      • see remark 999 (200)
      • engineered (218)
      • engineered (227)
      • engineered (300)
      • engineered (336)
      • engineered (386)
    Domains in SCOPe 2.07: d1xqja1, d1xqja2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xqjA (A:)
    hhhhhhenlyfqgsmdalqlansafavdlfkqlsekeplgnvlfspialstslslaqvga
    kgdtaneigqvlhfenvkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefis
    stkrpyakeletvdfkdkleetkgqinnsikdltdghfeniladnsvndqtkilvvnaay
    fvgkwmkkfsesetkespfrvnktdtkpvqmmnmeatfsmgnidsinskiielpfqnkhl
    smfillpkdvedestglekiekqlnseslsqwtnpstmanakvklsipkfkvekmidpka
    slenlglkhifsedtsdfsgmsetkgvalsnvihkvsleitedggdsievpgarilqhkd
    elnadhpfiyiirhnktrniiffgkfssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqjA (A:)
    qgsmdalqlansafavdlfkqlsekeplgnvlfspialstslslaqvgakgdtaneigqv
    lhfenvkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefisstkrpyakele
    tvdfkdkleetkgqinnsikdltdghfeniladnsvndqtkilvvnaayfvgkwmkkfse
    setkespfrvnktdtkpvqmmnmeatfsmgnidsinskiielpfqnkhlsmfillpkdve
    destglekiekqlnseslsqwtnpstmanakvklsipkfkvekmidpkaslenlglkhif
    sedtsdfsgmsetkgvalsnvihkvsleitedggdsievpgarilqhkdelnadhpfiyi
    irhnktrniiffgkfssp