PDB entry 1xqi

View 1xqi on RCSB PDB site
Description: Crystal Structure Analysis of an NDP kinase from Pyrobaculum aerophilum
Class: transferase
Keywords: alpha/beta sandwich, ferredoxin fold, TRANSFERASE
Deposited on 2004-10-12, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: ndk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZWY4 (Start-194)
      • engineered (32)
      • engineered (39)
      • modified residue (50)
      • engineered (70)
      • engineered (106)
      • modified residue (111)
      • engineered (116)
      • modified residue (119)
    Domains in SCOPe 2.07: d1xqia1
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: ndk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZWY4 (Start-194)
      • engineered (32)
      • engineered (39)
      • modified residue (50)
      • engineered (70)
      • engineered (106)
      • modified residue (111)
      • engineered (116)
      • modified residue (119)
    Domains in SCOPe 2.07: d1xqib_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: ndk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZWY4 (Start-194)
      • engineered (32)
      • engineered (39)
      • modified residue (50)
      • engineered (70)
      • engineered (106)
      • modified residue (111)
      • engineered (116)
      • modified residue (119)
    Domains in SCOPe 2.07: d1xqic_
  • Heterogens: TRS, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xqiA (A:)
    mhainiaffdlimpvektllilkpdavarglvdeiisrfkkaglkivalkmvkaspeeie
    rfypsseewlqsagqkllkayqelgidprakigtddpvevgriikrnlvkymtsgpnvvm
    vlkgnraveivrklvgptsphsappgtirgdysidspdlaaeegrvvfnlvhasdspsea
    ereirfwfreeevle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqiA (A:)
    pvektllilkpdavarglvdeiisrfkkaglkivalkmvkaspeeierfypsseewlqsa
    gqkllkayqelgidprakigtddpvevgriikrnlvkymtsgpnvvmvlkgnraveivrk
    lvgptsphsappgtirgdysidspdlaaeegrvvfnlvhasdspseaereirfwfreeev
    le
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xqiB (B:)
    mhainiaffdlimpvektllilkpdavarglvdeiisrfkkaglkivalkmvkaspeeie
    rfypsseewlqsagqkllkayqelgidprakigtddpvevgriikrnlvkymtsgpnvvm
    vlkgnraveivrklvgptsphsappgtirgdysidspdlaaeegrvvfnlvhasdspsea
    ereirfwfreeevle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqiB (B:)
    pvektllilkpdavarglvdeiisrfkkaglkivalkmvkaspeeierfypsseewlqsa
    gqkllkayqelgidprakigtddpvevgriikrnlvkymtsgpnvvmvlkgnraveivrk
    lvgptsphsappgtirgdysidspdlaaeegrvvfnlvhasdspseaereirfwfreeev
    le
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xqiC (C:)
    mhainiaffdlimpvektllilkpdavarglvdeiisrfkkaglkivalkmvkaspeeie
    rfypsseewlqsagqkllkayqelgidprakigtddpvevgriikrnlvkymtsgpnvvm
    vlkgnraveivrklvgptsphsappgtirgdysidspdlaaeegrvvfnlvhasdspsea
    ereirfwfreeevle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqiC (C:)
    pvektllilkpdavarglvdeiisrfkkaglkivalkmvkaspeeierfypsseewlqsa
    gqkllkayqelgidprakigtddpvevgriikrnlvkymtsgpnvvmvlkgnraveivrk
    lvgptsphsappgtirgdysidspdlaaeegrvvfnlvhasdspseaereirfwfreeev
    le