PDB entry 1xqh

View 1xqh on RCSB PDB site
Description: Crystal structure of a ternary complex of the methyltransferase SET9 (also known as SET7/9) with a P53 peptide and SAH
Class: transferase
Keywords: Set9-p53 complex, Set-domain, Lysine methylation, TRANSFERASE
Deposited on 2004-10-12, released 2004-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.186
AEROSPACI score: -1.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone-lysine n-methyltransferase, h3 lysine-4 specific
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xqha1, d1xqha2
  • Chain 'B':
    Compound: 9-mer peptide from tumor protein p53
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637 (0-End)
      • modified residue (3)
  • Chain 'E':
    Compound: histone-lysine n-methyltransferase, h3 lysine-4 specific
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xqhe1, d1xqhe2
  • Chain 'F':
    Compound: 9-mer peptide from tumor protein p53
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637 (0-End)
      • modified residue (3)
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xqhA (A:)
    gplgsgqykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidg
    emiegklatlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaesl
    issageglfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepyn
    hvskycaslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhspp
    gksgpeapewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqhA (A:)
    gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
    egrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskvav
    gpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghkan
    hsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpeapewyqve
    lkafqatqqk
    

  • Chain 'B':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xqhE (E:)
    gplgsgqykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidg
    emiegklatlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaesl
    issageglfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepyn
    hvskycaslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhspp
    gksgpeapewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqhE (E:)
    gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
    egrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskvav
    gpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghkan
    hsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpeapewyqve
    lkafqatqqk
    

  • Chain 'F':
    No sequence available.