PDB entry 1xqe

View 1xqe on RCSB PDB site
Description: The mechanism of ammonia transport based on the crystal structure of AmtB of E. coli.
Class: transport protein
Keywords: Ammonia transport, wild type, open conformation, TRANSPORT PROTEIN
Deposited on 2004-10-12, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ammonium transporter
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xqea_
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xqeA (A:)
    apavadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwv
    vygyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgala
    erirfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgay
    ligkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataa
    ailgwifgewalrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvt
    mlkrllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesia
    itivwsgvvafigykladltvglrvpeeqeregldvnshgenaynadqaqqpaqadle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqeA (A:)
    avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy
    gyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer
    irfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli
    gphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaailgwifgewalr
    gkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtmddpcdvfgvhgv
    cgivgcimtgifaasslggvgfaegvtmghqllvqlesiaitivwsgvvafigykladlt
    vglrvp