PDB entry 1xqd

View 1xqd on RCSB PDB site
Description: Crystal structure of P450NOR complexed with 3-pyridinealdehyde adenine dinucleotide
Class: oxidoreductase
Keywords: nitric oxide reductase, cytochrome p450nor, nadh complex, oxidoreductase
Deposited on 2004-10-12, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 55a1
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23295 (Start-402)
      • engineered (72)
      • engineered (74)
      • see remark 999 (182)
    Domains in SCOPe 2.07: d1xqda_
  • Heterogens: HEM, DND, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xqdA (A:)
    masgapsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatsekl
    skvrtrqgfpelgaggkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrt
    vddlleqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsst
    arqasaanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvag
    natmvnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmi
    gdklvranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlaka
    elttvfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqdA (A:)
    apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
    trqgfpelgaggkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
    leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarqa
    saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
    vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
    vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
    vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif