PDB entry 1xq7

View 1xq7 on RCSB PDB site
Description: Cyclophilin from Trypanosoma cruzi bound to cyclosporin A
Class: isomerase/immunosuppressant
Keywords: isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, cyclosporin a, immunosuppressant, cyclophilin, structural genomics, protein structure initiative, psi, structural genomics of pathogenic protozoa consortium, sgpp
Deposited on 2004-10-11, released 2004-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xq7a_
  • Chain 'B':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xq7b_
  • Chain 'C':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xq7c_
  • Chain 'D':
    Compound: cyclosporin a
    Species: TOLYPOCLADIUM INFLATUM 2, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'E':
    Compound: cyclosporin a
    Species: TOLYPOCLADIUM INFLATUM 2, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'F':
    Compound: cyclosporin a
    Species: TOLYPOCLADIUM INFLATUM 2, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xq7A (A:)
mpvvtdkvyfditigdepvgrvviglfgndvpktvenfkqlasgengfgykgsifhrvir
nfmiqggdftnfdgtggksiygtrfddenlkikhfvgavsmanagpnsngsqffvttapt
pwldgrhvvfgkvvegmdvvkkventktglndkpkkavkindcgvl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xq7B (B:)
mpvvtdkvyfditigdepvgrvviglfgndvpktvenfkqlasgengfgykgsifhrvir
nfmiqggdftnfdgtggksiygtrfddenlkikhfvgavsmanagpnsngsqffvttapt
pwldgrhvvfgkvvegmdvvkkventktglndkpkkavkindcgvl

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xq7C (C:)
mpvvtdkvyfditigdepvgrvviglfgndvpktvenfkqlasgengfgykgsifhrvir
nfmiqggdftnfdgtggksiygtrfddenlkikhfvgavsmanagpnsngsqffvttapt
pwldgrhvvfgkvvegmdvvkkventktglndkpkkavkindcgvl

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.