PDB entry 1xq6

View 1xq6 on RCSB PDB site
Description: X-ray Structure of Gene Product from Arabidopsis Thaliana At5g02240
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, CESG, AT5G02240, NADP, PSI, Center for Eukaryotic Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-10-11, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unknown protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g02240
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94EG6 (1-252)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1xq6a1, d1xq6a2
  • Chain 'B':
    Compound: unknown protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g02240
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94EG6 (1-252)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1xq6b1, d1xq6b2
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xq6A (A:)
    sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
    dsinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaa
    kvagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldk
    eggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptk
    dfkalfsqvtsrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xq6B (B:)
    sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
    dsinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaa
    kvagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldk
    eggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptk
    dfkalfsqvtsrf