PDB entry 1xq5

View 1xq5 on RCSB PDB site
Description: Met-Perch Hemoglobin at 1.9A
Class: oxygen storage/transport
Keywords: Fish Hemoglobin, rapid oxidation, structural genomics, protein structure initiative, PSI, CESG, Center for Eukaryotic Structural Genomics, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2004-10-11, released 2004-11-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.246
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin alpha-1 chain
    Species: Perca flavescens [TaxId:8167]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xq5a_
  • Chain 'B':
    Compound: Hemoglobin beta-2 chain
    Species: Perca flavescens [TaxId:8167]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XQ5 (0-145)
    Domains in SCOPe 2.04: d1xq5b_
  • Chain 'C':
    Compound: Hemoglobin alpha-1 chain
    Species: Perca flavescens [TaxId:8167]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xq5c_
  • Chain 'D':
    Compound: Hemoglobin beta-2 chain
    Species: Perca flavescens [TaxId:8167]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XQ5 (0-145)
    Domains in SCOPe 2.04: d1xq5d_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xq5A (A:)
    slsskdkdtvkalwgkiadkaeeigsdalsrmlavypqtktyfshwkdlspgsapvnkhg
    ktimggivdavasiddlnagllalselhaftlrvdpanfkilshcilvllavkfpkdftp
    evhisydkffsalaralaekyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xq5B (B:)
    vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
    akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
    afsgevqaafqkflsvvvsalgkqyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xq5C (C:)
    slsskdkdtvkalwgkiadkaeeigsdalsrmlavypqtktyfshwkdlspgsapvnkhg
    ktimggivdavasiddlnagllalselhaftlrvdpanfkilshcilvllavkfpkdftp
    evhisydkffsalaralaekyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xq5D (D:)
    vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
    akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
    afsgevqaafqkflsvvvsalgkqyh