PDB entry 1xq4

View 1xq4 on RCSB PDB site
Description: Crystal Structure of the Putative ApaA Protein from Bordetella pertussis, Northeast Structural Genomics Target BeR40
Class: structural genomics, unknown function
Keywords: all beta protein, Structural Genomics, Protein Structure Initiative, PSI, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2004-10-11, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein apaG
    Species: Bordetella pertussis [TaxId:520]
    Gene: apaG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VU61
      • modified residue (100)
      • modified residue (125)
    Domains in SCOPe 2.07: d1xq4a_
  • Chain 'B':
    Compound: Protein apaG
    Species: Bordetella pertussis [TaxId:520]
    Gene: apaG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VU61
      • modified residue (100)
      • modified residue (125)
    Domains in SCOPe 2.07: d1xq4b_
  • Chain 'C':
    Compound: Protein apaG
    Species: Bordetella pertussis [TaxId:520]
    Gene: apaG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VU61
      • modified residue (100)
      • modified residue (125)
    Domains in SCOPe 2.07: d1xq4c_
  • Chain 'D':
    Compound: Protein apaG
    Species: Bordetella pertussis [TaxId:520]
    Gene: apaG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VU61
      • modified residue (100)
      • modified residue (125)
    Domains in SCOPe 2.07: d1xq4d_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xq4A (A:)
    msnrerpvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitd
    geervqevrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpia
    efllamprtlhlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xq4A (A:)
    pvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitdgeervq
    evrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpiaefllam
    prt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xq4B (B:)
    msnrerpvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitd
    geervqevrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpia
    efllamprtlhlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xq4B (B:)
    pvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitdgeervq
    evrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpiaefllam
    p
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xq4C (C:)
    msnrerpvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitd
    geervqevrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpia
    efllamprtlhlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xq4C (C:)
    pvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitdgeervq
    evrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpiaefllam
    pr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xq4D (D:)
    msnrerpvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitd
    geervqevrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpia
    efllamprtlhlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xq4D (D:)
    pvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitdgeervq
    evrglgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpiaefllam
    pr