PDB entry 1xq3

View 1xq3 on RCSB PDB site
Description: Crystal structure of the human androgen receptor ligand binding domain bound with R1881
Class: transcription
Keywords: crystal structure; human androgen receptor ligand binding domain; R1881, TRANSCRIPTION
Deposited on 2004-10-11, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.215
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Ar, Nr3c4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xq3a_
  • Heterogens: R18, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xq3A (A:)
    piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
    ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
    sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
    scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
    vkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xq3A (A:)
    piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
    ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
    sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiatscsrrf
    yqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiyf
    htq