PDB entry 1xq2

View 1xq2 on RCSB PDB site
Description: Crystal structure of the human androgen receptor ligand binding domain bound with TIF2(III) 740-753 peptide and R1881
Deposited on 2004-10-11, released 2004-11-16
The last revision was dated 2005-08-30, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.221
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: HOMO SAPIENS
    Gene: Ar, Nr3c4
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 14-mer fragment of Nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: R18, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xq2A (A:)
    piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
    ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
    sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
    scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
    vkpiyfhtq
    

    Sequence, based on observed residues (ATOM records):
    >1xq2A (A:)
    piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
    ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
    sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiatscsrrf
    yqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiyf
    ht
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1xq2B (B:)
    kenallrylldkdd
    

    Sequence, based on observed residues (ATOM records):
    >1xq2B (B:)
    enallrylldk