PDB entry 1xq1

View 1xq1 on RCSB PDB site
Description: x-ray structure of putative tropinone reducatse from arabidopsis thaliana gene at1g07440
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, CESG, AT1G07440, REDUCTIVELY METHYLATED PROTEIN, PUTATIVE TROPINONE REDUCTASE, PSI, Center for Eukaryotic Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-10-11, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative tropinone reducatse
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g07440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xq1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xq1A (A:)
    magaeqsqrwslkaktvlvtggtkgighaiveefagfgavihtcarneyelneclskwqk
    kgfqvtgsvcdaslrpereklmqtvssmfggkldilinnlgairskptldytaedfsfhi
    stnlesayhlsqlahpllkasgcgniifmssiagvvsasvgsiysatkgalnqlarnlac
    ewasdgiranavapaviatplaeavyddefkkvvisrkplgrfgepeevsslvaflcmpa
    asyitgqticvdggltvngfsyqpqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xq1A (A:)
    sqrwslkaktvlvtggtkgighaiveefagfgavihtcarneyelneclskwqkkgfqvt
    gsvcdaslrpereklmqtvssmfggkldilinnlgaldytaedfsfhistnlesayhlsq
    lahpllkasgcgniifmsgsiysatkgalnqlarnlacewasdgiranavapaviagepe
    evsslvaflcmpaasyitgqticvdggltvngfsyqpq