PDB entry 1xpy

View 1xpy on RCSB PDB site
Description: Structural Basis for Catalytic Racemization and Substrate Specificity of an N-Acylamino Acid Racemase Homologue from Deinococcus radiodurans
Class: isomerase
Keywords: racemase
Deposited on 2004-10-10, released 2004-10-26
The last revision prior to the SCOP 1.75 freeze date was dated 2004-10-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acylamino acid racemase
    Species: Deinococcus radiodurans
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYA6 (Start-374)
      • see remark 999 (93)
      • see remark 999 (147)
      • see remark 999 (157)
      • see remark 999 (251)
      • see remark 999 (314)
    Domains in SCOP 1.75: d1xpya1, d1xpya2
  • Chain 'B':
    Compound: N-acylamino acid racemase
    Species: Deinococcus radiodurans
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYA6 (Start-374)
      • see remark 999 (93)
      • see remark 999 (147)
      • see remark 999 (157)
      • see remark 999 (251)
      • see remark 999 (314)
    Domains in SCOP 1.75: d1xpyb1, d1xpyb2
  • Chain 'C':
    Compound: N-acylamino acid racemase
    Species: Deinococcus radiodurans
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYA6 (Start-374)
      • see remark 999 (93)
      • see remark 999 (147)
      • see remark 999 (157)
      • see remark 999 (251)
      • see remark 999 (314)
    Domains in SCOP 1.75: d1xpyc1, d1xpyc2
  • Chain 'D':
    Compound: N-acylamino acid racemase
    Species: Deinococcus radiodurans
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYA6 (Start-374)
      • see remark 999 (93)
      • see remark 999 (147)
      • see remark 999 (157)
      • see remark 999 (251)
      • see remark 999 (314)
    Domains in SCOP 1.75: d1xpyd1, d1xpyd2
  • Heterogens: MG, NLQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xpyA (A:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpyA (A:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xpyB (B:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpyB (B:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xpyC (C:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpyC (C:)
    rmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearpmyree
    tiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvp
    lgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratre
    afpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcld
    esvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigr
    ahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflat
    vteaqeehra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xpyD (D:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpyD (D:)
    rmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearpmyree
    tiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvp
    lgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratre
    afpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcld
    esvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigr
    ahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflat
    vteaqeehra