PDB entry 1xpx

View 1xpx on RCSB PDB site
Description: Structural basis of prospero-DNA interaction; implications for transcription regulation in developing cells
Class: transcription regulation/DNA
Keywords: homeodomain, protein-DNA binding, prospero, neural cell development, TRANSCRIPTION REGULATION/DNA COMPLEX
Deposited on 2004-10-09, released 2005-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein prospero
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: PROS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xpxa_
  • Chain 'C':
    Compound: 5'-d(*cp*ap*gp*gp*cp*ap*tp*gp*cp*t)-3'
  • Chain 'D':
    Compound: 5'-d(*ap*gp*cp*ap*tp*gp*cp*cp*tp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xpxA (A:)
    tplhsstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyy
    iqmekyarqavtegiktpddlliagdselyrvlnlhynrnnhievpqnfrfvvestlref
    fraiqggkdteqswkksiykiisrmddpvpeyfkspnfleqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpxA (A:)
    sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
    kyarqavteselyrvlnlhynrnnhievpqnfrfvvestlreffraiqggkdteqswkks
    iykiisrmddpvpeyfkspnfleq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.