PDB entry 1xpw

View 1xpw on RCSB PDB site
Description: Solution NMR Structure of human protein HSPCO34. Northeast Structural Genomics Target HR1958
Class: Structural Genomics, Unknown Function
Keywords: gene PP25, locus LOC51668, C1orf41, homo sapiens, NESGC cluster id 3237, target HR1958, structural genomics, APC10-related protein, Northeast Structural Genomics Consortium, protein structure initiative, PSI, jellyroll, Beta-sandwich, Unknown Function
Deposited on 2004-10-09, released 2004-11-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LOC51668 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PP25
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xpwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1xpwA (A:)
mghhhhhhshmrkidlclssegsevilatssdekhppeniidgnpetfwtttgmfpqefi
icfhkhvrierlviqsyfvqtlkiekstskepvdfeqwiekdlvhtegqlqneeivahgs
atylrfiivsafdhfasvhsvsaegtvvsnlss

    Sequence, based on observed residues (ATOM records): (download) 
    >1xpwA (A:)
mrkidlclssegsevilatssdekhppeniidgnpetfwtttgmfpqefiicfhkhvrie
rlviqsyfvqtlkiekstskepvdfeqwiekdlvhtegqlqneeivahgsatylrfiivs
afdhfasvhsvsaegtvvsnlss