PDB entry 1xpv

View 1xpv on RCSB PDB site
Description: Solution Structure of Northeast Structural Genomics Target Protein XcR50 from X. Campestris
Class: Structural genomics, unknown function
Keywords: ALPHA+BETA, GFT NMR, Structural Genomics, NESGC, XcR50, protein structure initiative, PSI, Northeast Structural Genomics Consortium
Deposited on 2004-10-09, released 2004-12-14
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-22, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein XCC2852
  Species: Xanthomonas campestris
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8P6W3 (0-77)
  Domains in SCOP 1.73: d1xpva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xpvA (A:)
  maltlyqrddchlcdqavealaqaragaffsvfidddaalesayglrvpvlrdpmgreld
  wpfdaprlrawldaapha