PDB entry 1xpv

View 1xpv on RCSB PDB site
Description: solution structure of northeast structural genomics target protein xcr50 from x. campestris
Deposited on 2004-10-09, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1xpva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xpvA (A:)
  maltlyqrddchlcdqavealaqaragaffsvfidddaalesayglrvpvlrdpmgreld
  wpfdaprlrawldaapha