PDB entry 1xpu

View 1xpu on RCSB PDB site
Description:
Deposited on 2004-10-09, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.288
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xpuA (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpuA (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xpuB (B:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpuB (B:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xpuC (C:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpuC (C:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xpuD (D:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpuD (D:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xpuE (E:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpuE (E:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpaltggvdanalhrpkrffgaarnveeg
    gsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeel
    lttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xpuF (F:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpuF (F:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk