PDB entry 1xpr

View 1xpr on RCSB PDB site
Description: Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-formylbicyclomycin (FB)
Class: transcription/RNA
Keywords: Rho; 5a-formylbicyclomycin; FB; ATPgammaS, TRANSCRIPTION-RNA COMPLEX
Deposited on 2004-10-09, released 2004-11-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.284
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho transcription termination factor
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xpra1, d1xpra2, d1xpra3
  • Chain 'B':
    Compound: Rho transcription termination factor
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xprb1, d1xprb2, d1xprb3
  • Chain 'C':
    Compound: Rho transcription termination factor
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xprc1, d1xprc2, d1xprc3
  • Chain 'D':
    Compound: Rho transcription termination factor
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xprd1, d1xprd2, d1xprd3
  • Chain 'E':
    Compound: Rho transcription termination factor
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xpre1, d1xpre2, d1xpre3
  • Chain 'F':
    Compound: Rho transcription termination factor
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xprf1, d1xprf2, d1xprf3
  • Chain 'G':
    Compound: 5'-r(*cp*up*cp*up*cp*up*cp*u)-3'
    Species:
    Gene:
  • Chain 'H':
    Compound: 5'-r(*cp*up*cp*up*cp*up*cp*u)-3'
    Species:
    Gene:
  • Chain 'J':
    Compound: 5'-r(*cp*up*cp*up*cp*up*cp*u)-3'
    Species:
    Gene:
  • Chain 'K':
    Compound: 5'-r(*cp*up*cp*up*cp*up*cp*u)-3'
    Species:
    Gene:
  • Chain 'L':
    Compound: 5'-r(*cp*up*cp*up*cp*up*cp*u)-3'
    Species:
    Gene:
  • Chain 'M':
    Compound: 5'-r(*cp*up*cp*up*cp*up*cp*u)-3'
    Species:
    Gene:
  • Heterogens: MG, AGS, FB

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xprA (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xprA (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xprB (B:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xprB (B:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xprC (C:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xprC (C:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xprD (D:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xprD (D:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xprE (E:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xprE (E:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpaltggvdanalhrpkrffgaarnveeg
    gsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeel
    lttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xprF (F:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xprF (F:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.