PDB entry 1xpq

View 1xpq on RCSB PDB site
Description: Crystal structure of fms1, a polyamine oxidase from yeast
Deposited on 2004-10-09, released 2005-04-26
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.232
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FMS1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FMS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50264 (Start-507)
      • cloning artifact (508-512)
  • Chain 'B':
    Compound: FMS1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FMS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50264 (Start-507)
      • cloning artifact (508)
  • Chain 'C':
    Compound: FMS1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FMS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50264 (Start-507)
      • cloning artifact (508-509)
  • Chain 'D':
    Compound: FMS1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FMS1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SPM, FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xpqA (A:)
    mntvspakkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkyd
    igaswhhdtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdn
    emskfaelefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwk
    llsakdtyfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvnced
    gtvynadyviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvife
    feeccwsnesskivtlanstnefveivrnaenldeldsmleredsqkhtsvtcwsqplff
    vnlskstgvasfmmlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrp
    ienianankpvlrniivsnwtrdpysrgaysacfpgddpvdmvvamsngqdsrirfageh
    timdgagcaygawesgrreatrisdllklehhh
    

    Sequence, based on observed residues (ATOM records):
    >1xpqA (A:)
    pakkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkydigasw
    hhdtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdnemskf
    aelefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwkllsak
    dtyfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvncedgtvyn
    adyviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvifefeecc
    wsnesskivtlanstnefveivrnaenldeldsmlertsvtcwsqplffvnlskstgvas
    fmmlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrpienianankpv
    lrniivsnwtrdpysrgaysacfpvdmvvamsngqdsrirfagehtimdgagcaygawes
    grreatrisdllklehhh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1xpqB (B:)
    mntvspakkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkyd
    igaswhhdtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdn
    emskfaelefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwk
    llsakdtyfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvnced
    gtvynadyviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvife
    feeccwsnesskivtlanstnefveivrnaenldeldsmleredsqkhtsvtcwsqplff
    vnlskstgvasfmmlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrp
    ienianankpvlrniivsnwtrdpysrgaysacfpgddpvdmvvamsngqdsrirfageh
    timdgagcaygawesgrreatrisdllklehhh
    

    Sequence, based on observed residues (ATOM records):
    >1xpqB (B:)
    kkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkydigaswhh
    dtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdnemskfae
    lefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwkllsakdt
    yfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvncedgtvynad
    yviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvifefeeccws
    nesskivtlanstnefveivrnaenldeldsmlertsvtcwsqplffvnlskstgvasfm
    mlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrpienianankpvlr
    niivsnwtrdpysrgaysacfpvdmvvamsngqdsrirfagehtimdgagcaygawesgr
    reatrisdllkl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1xpqC (C:)
    mntvspakkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkyd
    igaswhhdtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdn
    emskfaelefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwk
    llsakdtyfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvnced
    gtvynadyviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvife
    feeccwsnesskivtlanstnefveivrnaenldeldsmleredsqkhtsvtcwsqplff
    vnlskstgvasfmmlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrp
    ienianankpvlrniivsnwtrdpysrgaysacfpgddpvdmvvamsngqdsrirfageh
    timdgagcaygawesgrreatrisdllklehhh
    

    Sequence, based on observed residues (ATOM records):
    >1xpqC (C:)
    pakkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkydigasw
    hhdtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdnemskf
    aelefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwkllsak
    dtyfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvncedgtvyn
    adyviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvifefeecc
    wsnesskivtlanstnefveivrnaenldeldsmlertsvtcwsqplffvnlskstgvas
    fmmlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrpienianankpv
    lrniivsnwtrdpysrgaysacfpvdmvvamsngqdsrirfagehtimdgagcaygawes
    grreatrisdllkle
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1xpqD (D:)
    mntvspakkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkyd
    igaswhhdtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdn
    emskfaelefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwk
    llsakdtyfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvnced
    gtvynadyviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvife
    feeccwsnesskivtlanstnefveivrnaenldeldsmleredsqkhtsvtcwsqplff
    vnlskstgvasfmmlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrp
    ienianankpvlrniivsnwtrdpysrgaysacfpgddpvdmvvamsngqdsrirfageh
    timdgagcaygawesgrreatrisdllklehhh
    

    Sequence, based on observed residues (ATOM records):
    >1xpqD (D:)
    kkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkydigaswhh
    dtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdnemskfae
    lefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwkllsakdt
    yfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvncedgtvynad
    yviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvifefeeccws
    nesskivtlanstnefveivrnaenldeldsmlertsvtcwsqplffvnlskstgvasfm
    mlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrpienianankpvlr
    niivsnwtrdpysrgaysacfpvdmvvamsngqdsrirfagehtimdgagcaygawesgr
    reatrisdll