PDB entry 1xpo

View 1xpo on RCSB PDB site
Description: Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic bicyclomycin
Class: transcription/RNA
Keywords: Rho; Bicyclomycin, TRANSCRIPTION-RNA COMPLEX
Deposited on 2004-10-09, released 2005-02-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.29
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho transcription termination factor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xpoa1, d1xpoa2, d1xpoa3
  • Chain 'B':
    Compound: Rho transcription termination factor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xpob1, d1xpob2, d1xpob3
  • Chain 'C':
    Compound: Rho transcription termination factor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xpoc1, d1xpoc2, d1xpoc3
  • Chain 'D':
    Compound: Rho transcription termination factor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xpod1, d1xpod2, d1xpod3
  • Chain 'E':
    Compound: Rho transcription termination factor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xpoe1, d1xpoe2, d1xpoe3
  • Chain 'F':
    Compound: Rho transcription termination factor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xpof1, d1xpof2, d1xpof3
  • Chain 'G':
    Compound: 5'-r(*cp*up*cp*up*cp*up*cp*u)-3'
  • Chain 'H':
    Compound: 5'-r(*cp*up*cp*up*cp*up*cp*u)-3'
  • Chain 'J':
    Compound: 5'-r(*cp*up*cp*up*cp*up*cp*u)-3'
  • Chain 'K':
    Compound: 5'-r(*cp*up*cp*up*cp*up*cp*u)-3'
  • Chain 'L':
    Compound: 5'-r(*cp*up*cp*up*cp*up*cp*u)-3'
  • Chain 'M':
    Compound: 5'-r(*cp*up*cp*up*cp*up*cp*u)-3'
  • Heterogens: MG, AGS, BCM

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xpoA (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpoA (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xpoB (B:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpoB (B:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xpoC (C:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpoC (C:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xpoD (D:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpoD (D:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xpoE (E:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpoE (E:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpaltggvdanalhrpkrffgaarnveeg
    gsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeel
    lttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xpoF (F:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpoF (F:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.