PDB entry 1xpn

View 1xpn on RCSB PDB site
Description: NMR structure of P. aeruginosa protein PA1324: Northeast Structural Genomics Consortium target PaP1
Deposited on 2004-10-08, released 2004-11-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-23, with a file datestamp of 2004-11-23.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xpna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xpnA (A:)
    gsshhhhhhssglvprgshmasnpndlpdfpeheyaatqqvgggvingdlyltsasgaiq
    kgtntkvalepatsymkayyakfgnldaakrdpdvqppvldprratyvreattdqngrfd
    fdhipngtyyisseltwsaqsdgktiteggtvtklvtvsgsqpqkvlltr