PDB entry 1xpl

View 1xpl on RCSB PDB site
Description: Crystal Structure of Staphylococcus aureus HMG-COA Synthase with Acetoacetyl-COA and Acetylated Cysteine
Class: transferase
Keywords: HMG-COA Synthase, HMGS, Coenzyme A, Thiolase Fold, Condensing Enzyme, Cholesterol Biosynthesis, TRANSFERASE
Deposited on 2004-10-08, released 2004-11-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxy-3-methylglutaryl CoA synthase
    Species: Staphylococcus aureus [TaxId:46170]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79ZY6 (Start-387)
      • cloning artifact (1)
      • microheterogeneity (110)
      • cloning artifact (388-389)
    Domains in SCOPe 2.06: d1xpla1, d1xpla2, d1xpla3, d1xpla4
  • Chain 'B':
    Compound: 3-hydroxy-3-methylglutaryl CoA synthase
    Species: Staphylococcus aureus [TaxId:46170]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79ZY6 (Start-387)
      • cloning artifact (1)
      • microheterogeneity (110)
      • cloning artifact (388-389)
    Domains in SCOPe 2.06: d1xplb1, d1xplb2, d1xplb3, d1xplb4
  • Chain 'C':
    Compound: 3-hydroxy-3-methylglutaryl CoA synthase
    Species: Staphylococcus aureus [TaxId:46170]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79ZY6 (Start-387)
      • cloning artifact (1)
      • microheterogeneity (110)
      • cloning artifact (388-389)
    Domains in SCOPe 2.06: d1xplc1, d1xplc2, d1xplc3, d1xplc4
  • Chain 'D':
    Compound: 3-hydroxy-3-methylglutaryl CoA synthase
    Species: Staphylococcus aureus [TaxId:46170]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79ZY6 (Start-387)
      • cloning artifact (1)
      • microheterogeneity (110)
      • cloning artifact (388-389)
    Domains in SCOPe 2.06: d1xpld1, d1xpld2, d1xpld3, d1xpld4
  • Heterogens: SO4, CAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xplA (A:)
    maigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xplA (A:)
    aigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpele
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xplB (B:)
    maigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xplB (B:)
    aigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpele
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xplC (C:)
    maigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xplC (C:)
    aigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpele
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xplD (D:)
    maigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xplD (D:)
    aigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpele