PDB entry 1xpj

View 1xpj on RCSB PDB site
Description: Crystal Structure of MCSG Target APC26283 from Vibrio cholerae
Class: structural genomics, unknown function
Keywords: Structural Genomics, Hypothetical Protein, MCSG, protein structure initiative, PSI, Midwest Center for Structural Genomics, unknown function
Deposited on 2004-10-08, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xpja_
  • Chain 'B':
    Compound: hypothetical protein
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xpjb_
  • Chain 'C':
    Compound: hypothetical protein
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xpjc_
  • Chain 'D':
    Compound: hypothetical protein
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xpjd_
  • Heterogens: HG, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xpjA (A:)
    mkklivdldgtltqantsdyrnvlprldvieqlreyhqlgfeivistarnmrtyegnvgk
    inihtlpiitewldkhqvpydeilvgkpwcghdgfyiddravrpsefasmnleeihqlfe
    kekscs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpjA (A:)
    mkklivdldgtltqantsdyrnvlprldvieqlreyhqlgfeivistarnmrtyegnvgk
    inihtlpiitewldkhqvpydeilvgkpwcghdgfyiddravrpsefasmnleeihqlfe
    keks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xpjB (B:)
    mkklivdldgtltqantsdyrnvlprldvieqlreyhqlgfeivistarnmrtyegnvgk
    inihtlpiitewldkhqvpydeilvgkpwcghdgfyiddravrpsefasmnleeihqlfe
    kekscs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpjB (B:)
    mkklivdldgtltqantsdyrnvlprldvieqlreyhqlgfeivistarnmrtyegnvgk
    inihtlpiitewldkhqvpydeilvgkpwcghdgfyiddravrpsefasmnleeihqlfe
    kek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xpjC (C:)
    mkklivdldgtltqantsdyrnvlprldvieqlreyhqlgfeivistarnmrtyegnvgk
    inihtlpiitewldkhqvpydeilvgkpwcghdgfyiddravrpsefasmnleeihqlfe
    kekscs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpjC (C:)
    mkklivdldgtltqantsdyrnvlprldvieqlreyhqlgfeivistarnmrtyegnvgk
    inihtlpiitewldkhqvpydeilvgkpwcghdgfyiddravrpsefasmnleeihqlfe
    kek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xpjD (D:)
    mkklivdldgtltqantsdyrnvlprldvieqlreyhqlgfeivistarnmrtyegnvgk
    inihtlpiitewldkhqvpydeilvgkpwcghdgfyiddravrpsefasmnleeihqlfe
    kekscs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpjD (D:)
    mkklivdldgtltqantsdyrnvlprldvieqlreyhqlgfeivistarnmrtyegnvgk
    inihtlpiitewldkhqvpydeilvgkpwcghdgfyiddravrpsefasmnleeihqlfe
    kek