PDB entry 1xpi

View 1xpi on RCSB PDB site
Description: Crystal structure of the catalytic domain of E. coli pseudouridine synthase RluC
Deposited on 2004-10-08, released 2005-10-04
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal large subunit pseudouridine synthase C
    Species: Escherichia coli [TaxId:562]
    Gene: rluc
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ribosomal large subunit pseudouridine synthase C
    Species: Escherichia coli [TaxId:562]
    Gene: rluc
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xpiA (A:)
    aaladvilyeddhilvlnkpsgtavhggsglsfgvieglralrpearflelvhrldrdts
    gvllvakkrsalrslheqlrekgmqkdylalvrgqwqshvksvqapllknilqsgerivr
    vsqegkpsetrfkveeryafatlvrcspvtgrthqirvhtqyaghpiafddrygdrefdr
    qlteagtglnrlflhaaalkfthpgtgevmrieapmdeglkrclqklrnar
    

    Sequence, based on observed residues (ATOM records):
    >1xpiA (A:)
    aaladvilyeddhilvlnkpsgtavhggsglsfgvieglralrarflelvhrldrdtsgv
    llvakkrsalrslheqlrekgmqkdylalvrgqwqshvksvqapllknilqsgerivrvs
    qegkpsetrfkveeryafatlvrcspvtgrthqirvhtqyaghpiafddrygdrefdrql
    teagtglnrlflhaaalkfthpgtgevmrieapmdeglkrclqklrnar
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1xpiB (B:)
    aaladvilyeddhilvlnkpsgtavhggsglsfgvieglralrpearflelvhrldrdts
    gvllvakkrsalrslheqlrekgmqkdylalvrgqwqshvksvqapllknilqsgerivr
    vsqegkpsetrfkveeryafatlvrcspvtgrthqirvhtqyaghpiafddrygdrefdr
    qlteagtglnrlflhaaalkfthpgtgevmrieapmdeglkrclqklrnar
    

    Sequence, based on observed residues (ATOM records):
    >1xpiB (B:)
    aaladvilyeddhilvlnkpsgtavhggsglsfgvieglralrpearflelvhrldrdts
    gvllvakkrsalrslheqlrekgmqkdylalvrgqwqshvksvqapllknilqsgerivr
    vsqegkpsetrfkveeryafatlvrcspvtgrthqirvhtqyaghpiafddrygdrefdr
    qlteagtglnrlflhaaalkfthpgtgevmrieapmdeglkrclqklrn