PDB entry 1xpa

View 1xpa on RCSB PDB site
Description: solution structure of the DNA-and rpa-binding domain of the human repair factor xpa, nmr, 1 structure
Class: DNA repair
Keywords: DNA repair, nucleotide excision repair, zinc-finger
Deposited on 1998-07-06, released 1999-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xpa
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xpaa1, d1xpaa2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xpaA (A:)
    mefdyviceecgkefmdsylmnhfdlptcdncrdaddkhklitkteakqeyllkdcdlek
    repplkfivkknphhsqwgdmklylklqivkrslevwgsqealeeakevrqenrekmkqk
    kf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpaA (A:)
    mefdyviceecgkefmdsylmnhfdlptcdncrdaddkhklitkteakqeyllkdcdlek
    repplkfivkknphhsqwgdmklylklqivkrslevwgsqealeeakevrqen