PDB entry 1xp8

View 1xp8 on RCSB PDB site
Description: Deinococcus radiodurans RecA in complex with ATP-gamma-S
Class: DNA binding protein
Keywords: Recombination, Radioresistance, DNA-repair, ATPase, DNA-binding protein, DNA BINDING PROTEIN
Deposited on 2004-10-08, released 2004-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reca protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: recA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xp8a1, d1xp8a2
  • Heterogens: AGS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xp8A (A:)
    gshmskdatkeisaptdakerskaietamsqiekafgkgsimklgaeskldvqvvstgsl
    sldlalgvggiprgriteiygpesggkttlalaivaqaqkaggtcafidaehaldpvyar
    algvntdellvsqpdngeqaleimellvrsgaidvvvvdsvaaltpraeiegdmgdslpg
    lqarlmsqalrkltailsktgtaaifinqvrekigvmygnpetttggralkfyasvrldv
    rkigqptkvgndavantvkiktvknkvaapfkevelalvygkgfdqlsdlvglaadmdii
    kkagsfysygderigqgkektiayiaerpemeqeirdrvmaairagnageapalapapaa
    peaaea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xp8A (A:)
    akerskaietamsqiekafgkgsimklgaeskldvqvvstgslsldlalgvggiprgrit
    eiygpesggkttlalaivaqaqkaggtcafidaehaldpvyaralgvntdellvsqpdng
    eqaleimellvrsgaidvvvvdsvaaltpraeipglqarlmsqalrkltailsktgtaai
    finqvggralkfyasvrldvrkigqptvantvkiktvknkvaapfkevelalvygkgfdq
    lsdlvglaadmdiikkagsfysygderigqgkektiayiaerpemeqeirdrvmaair