PDB entry 1xp3

View 1xp3 on RCSB PDB site
Description: Crystal Structure of Endonuclease IV (BA4508) from Bacillus anthracis at 2.57A Resolution.
Class: hydrolase
Keywords: endonuclease IV, nfo, DNA replication, DNA recombination, DNA repair, SPINE, Structural Genomics, Structural Proteomics in Europe, HYDROLASE
Deposited on 2004-10-08, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.155
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endonuclease IV
    Species: Bacillus anthracis [TaxId:1392]
    Gene: nfo
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81LV1 (Start-306)
      • conflict (76)
    Domains in SCOPe 2.07: d1xp3a1
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xp3A (A:)
    gsshhhhhhmlkigshvsmsgkkmllaaseeavsygattfmiytgapqntrrkpieelni
    eagrkhmeqngieeiiihapyiinvgnttkpetfqlgvdflrmeiertsalgvakqivlh
    pgahvgagadagiqqiikglnevltpdqtvnialetmagkgtecgrsfeeiakiidgvky
    neklsvcfdtchthdagydivnnfdgvlnefdkivgidrlqvlhindsknvrgagkdrhe
    nigfghigykalhhivhhpqlthvpkiletpyvgedkkdkkppykleiemlkngtfdegl
    lekikaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xp3A (A:)
    lkigshvsmsgkkmllaaseeavsygattfmiytgapqntrrkpieelnieagrkhmeqn
    gieeiiihapyiinvgnttkpetfqlgvdflrmeiertsalgvakqivlhpgahvgagad
    agiqqiikglnevltpdqtvnialetmagkgtecgrsfeeiakiidgvkyneklsvcfdt
    chthdagydivnnfdgvlnefdkivgidrlqvlhindsknvrgagkdrhenigfghigyk
    alhhivhhpqlthvpkiletpyvgedkkdkkppykleiemlkngtfdegllekikaq