PDB entry 1xp2

View 1xp2 on RCSB PDB site
Description: Crystal structure of the enzymatically active domain of the listeria monocytogenes bacteriophage 500 endolysin Ply500
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-10-08, released 2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-02-19, with a file datestamp of 2008-02-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-alanyl-d-glutamate peptidase
    Species: Bacteriophage A500
    Gene: PLY500
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q37979 (12-End)
      • expression tag (11)
  • Chain 'B':
    Compound: l-alanyl-d-glutamate peptidase
    Species: Bacteriophage A500
    Gene: PLY500
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q37979 (12-End)
      • expression tag (11)
    Domains in SCOPe 2.07: d1xp2b1, d1xp2b2
  • Chain 'C':
    Compound: l-alanyl-d-glutamate peptidase
    Species: Bacteriophage A500
    Gene: PLY500
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q37979 (12-End)
      • expression tag (11)
    Domains in SCOPe 2.07: d1xp2c1, d1xp2c2
  • Heterogens: ZN, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xp2B (B:)
    aswshpqfekgamalteawliekanrklnaggmykitsdktrnvikkmakegiylcvaqg
    yrstaeqnalyaqgrtkpgaivtnakggqsnhnygvavdlclytndgkdviwesttsrwk
    kvvaamkaegfkwggdwksfkdyphfelcdavsgekipaatqntntnsnryegkvidsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xp2B (B:)
    amalteawliekanrklnaggmykitsdktrnvikkmakegiylcvaqgyrstaeqnaly
    aqgrtkpgaivtnakggqsnhnygvavdlclytndgkdviwesttsrwkkvvaamkaegf
    kwggdwksfkdyphfelcdavsgekipaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xp2C (C:)
    aswshpqfekgamalteawliekanrklnaggmykitsdktrnvikkmakegiylcvaqg
    yrstaeqnalyaqgrtkpgaivtnakggqsnhnygvavdlclytndgkdviwesttsrwk
    kvvaamkaegfkwggdwksfkdyphfelcdavsgekipaatqntntnsnryegkvidsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xp2C (C:)
    amalteawliekanrklnaggmykitsdktrnvikkmakegiylcvaqgyrstaeqnaly
    aqgrtkpgaivtnakggqsnhnygvavdlclytndgkdviwesttsrwkkvvaamkaegf
    kwggdwksfkdyphfelcdavsgekipaa