PDB entry 1xoy

View 1xoy on RCSB PDB site
Description: Solution structure of At3g04780.1, an Arabidopsis ortholog of the C-terminal domain of human thioredoxin-like protein
Class: Structural Genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, PSI, CESG, Structural Genomics, unknown function
Deposited on 2004-10-07, released 2004-10-12
The last revision prior to the SCOP 1.75 freeze date was dated 2008-02-12, with a file datestamp of 2008-02-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein At3g04780.1
  Species: Arabidopsis thaliana
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9SQZ9 (1-160)
    • cloning artifact (0)
  Domains in SCOP 1.75: d1xoya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xoyA (A:)
  ssaesasqipkgqvdlldfidwsgveclnqssshslpnalkqgyredeglnlesdadeql
  liyipfnqviklhsfaikgpeeegpktvkffsnkehmcfsnvndfppsdtaelteenlkg
  kpvvlkyvkfqnvrsltifieanqsgsevtkvqkialygst