PDB entry 1xoy

View 1xoy on RCSB PDB site
Description: Solution structure of At3g04780.1, an Arabidopsis ortholog of the C-terminal domain of human thioredoxin-like protein
Class: Structural Genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, PSI, CESG, unknown function
Deposited on 2004-10-07, released 2004-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein At3g04780.1
  Species: Arabidopsis thaliana [TaxId:3702]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9SQZ9 (1-160)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d1xoya1, d1xoya2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xoyA (A:)
  ssaesasqipkgqvdlldfidwsgveclnqssshslpnalkqgyredeglnlesdadeql
  liyipfnqviklhsfaikgpeeegpktvkffsnkehmcfsnvndfppsdtaelteenlkg
  kpvvlkyvkfqnvrsltifieanqsgsevtkvqkialygst