PDB entry 1xox

View 1xox on RCSB PDB site
Description: solution structure of human survivin
Class: apoptosis
Keywords: Bir Domain; Apoptosis
Deposited on 2004-10-07, released 2005-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: apoptosis inhibitor survivin
  Species: Homo sapiens [TaxId:9606]
  Gene: BIRC5, API4, IAP4
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15392 (0-116)
  Domains in SCOPe 2.08: d1xoxa_
• Chain 'B':
  Compound: apoptosis inhibitor survivin
  Species: Homo sapiens [TaxId:9606]
  Gene: BIRC5, API4, IAP4
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15392 (0-116)
  Domains in SCOPe 2.08: d1xoxb_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xoxA (A:)
  mgaptlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffc
  fkelegwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xoxB (B:)
  mgaptlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffc
  fkelegwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket