PDB entry 1xow

View 1xow on RCSB PDB site
Description: Crystal structure of the human androgen receptor ligand binding domain bound with an androgen receptor NH2-terminal peptide, AR20-30, and R1881
Class: transcription
Keywords: crystal structure; human androgen receptor ligand binding domain; androgen receptor NH2-terminal peptide AR20-30; R1881, TRANSCRIPTION
Deposited on 2004-10-07, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Ar, Nr3c4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xowa_
  • Chain 'B':
    Compound: decamer fragment of androgen receptor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: R18, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xowA (A:)
    piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
    ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
    sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
    scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
    vkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xowA (A:)
    piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
    ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
    sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiatscsrrf
    yqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiyf
    htq
    

  • Chain 'B':
    No sequence available.