PDB entry 1xov

View 1xov on RCSB PDB site
Description: The crystal structure of the listeria monocytogenes bacteriophage PSA endolysin PlyPSA
Class: hydrolase
Keywords: alpha/beta hydrolase, multi-domain, hydrolase
Deposited on 2004-10-07, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ply protein
    Species: Listeria phage PSA [TaxId:171618]
    Gene: ply
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8W5Y8 (12-325)
      • expression tag (11)
    Domains in SCOPe 2.07: d1xova1, d1xova2, d1xova3
  • Heterogens: ZN, SO4, CL, GLU, LYS, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xovA (A:)
    aswshpqfekgamsnysmsrghsdkcvgaedilseikeaekvlnaasdelkreghnvktf
    idrtsttqsanlnkivnwhnanpadvhisvhlnagkgtgvevwyyagdekgrklaveisa
    kmakalglpnrgakatkdlrflnstkgtavllevcfvdrkedanaihksgmydklgiaia
    egltgktvaaknpnrhsgavvdsvpmlskmdfksspikmykagssllvyehnkywykayi
    ndklcyiyksfcisngkkdakgrikvriksakdlripvwnntklnsgkikwyspgtklsw
    ydnkkgylelwyekdgwyytanyflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xovA (A:)
    amsnysmsrghsdkcvgaedilseikeaekvlnaasdelkreghnvktfidrtsttqsan
    lnkivnwhnanpadvhisvhlnagkgtgvevwyyagdekgrklaveisakmakalglpnr
    gakatkdlrflnstkgtavllevcfvdrkedanaihksgmydklgiaiaegltgktvaak
    npnrhsgavvdsvpmlskmdfksspikmykagssllvyehnkywykayindklcyiyksf
    cisngkkdakgrikvriksakdlripvwnntklnsgkikwyspgtklswydnkkgylelw
    yekdgwyytanyflk