PDB entry 1xou

View 1xou on RCSB PDB site
Description: Crystal structure of the CesA-EspA complex
Deposited on 2004-10-06, released 2004-12-28
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xoua_
  • Chain 'B':
    Domains in SCOP 1.71: d1xoub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xouA (A:)
    mdtsttasvasanaststsmaydlgsmskddvidlfnklgvfqaailmfaymyqaqsdls
    iakfadmneaskesttaqkmanlvdakiadvqsssdknakaqlpdevisyindprnditi
    sgidninaqlgagdlqtvkaaisakannltttvnnsqleiqqmsntlnlltsarsdmqsl
    qyrtisgislgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xouA (A:)
    dvidlfnklgvfqaailmfaymyqaqsdlnltttvnnsqleiqqmsntlnlltsarsdmq
    slqyrtisgisl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xouB (B:)
    mgivsqtrnkelldkkirseieaikkiiaefdvvkesvnelsekaktdpqaaeklnklie
    gytygeerklydsalskieklietlsparsksqst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xouB (B:)
    givsqtrnkelldkkirseieaikkiiaefdvvkesvnelsekaktdpqaaeklnklieg
    ytygeerklydsalskieklietl