PDB entry 1xot

View 1xot on RCSB PDB site
Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With Vardenafil
Deposited on 2004-10-06, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.213
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xota_
  • Chain 'B':
    Domains in SCOP 1.71: d1xotb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xotA (A:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsp
    pldeqnrdcqglmekfqfeltldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xotA (A:)
    edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
    ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
    nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
    latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
    yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
    qpdaqdildtlednrnwyqsmip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xotB (B:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsp
    pldeqnrdcqglmekfqfeltldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xotB (B:)
    edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
    ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
    nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
    latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
    yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
    qpdaqdildtlednrnwyqsmip