PDB entry 1xom

View 1xom on RCSB PDB site
Description: Catalytic Domain Of Human Phosphodiesterase 4D In Complex With Cilomilast
Class: hydrolase
Keywords: Phosphodiesterase, PDE, PDE4D, Cilomilast, HYDROLASE
Deposited on 2004-10-06, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.184
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xoma_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xomb_
  • Heterogens: ZN, MG, CIO, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xomA (A:)
    mgsshhhhhhssglvprgshmteqedvlakeledvnkwglhvfriaelsgnrpltvimht
    ifqerdllktfkipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleav
    ftdleilaaifasaihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqee
    ncdifqnltkkqrqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnys
    driqvlqnmvhcadlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnas
    veksqvgfidyivhplwetwadlvhpdaqdildtlednrewyqstipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xomA (A:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xomB (B:)
    mgsshhhhhhssglvprgshmteqedvlakeledvnkwglhvfriaelsgnrpltvimht
    ifqerdllktfkipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleav
    ftdleilaaifasaihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqee
    ncdifqnltkkqrqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnys
    driqvlqnmvhcadlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnas
    veksqvgfidyivhplwetwadlvhpdaqdildtlednrewyqstipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xomB (B:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtvllldnysdriqvlqnmvhcadlsnptkplqlyr
    qwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvhp
    daqdildtlednrewyqstip