PDB entry 1xoi

View 1xoi on RCSB PDB site
Description: Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide
Class: transferase
Keywords: Allosteric enzyme, Glycogen storage disease, glycosyltransferase, TRANSFERASE
Deposited on 2004-10-06, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06737
      • conflict (322)
    Domains in SCOPe 2.07: d1xoia_
  • Chain 'B':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06737
      • conflict (322)
    Domains in SCOPe 2.07: d1xoib_
  • Heterogens: NBG, PLP, 288, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xoiA (A:)
    akpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtvr
    dhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldie
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveead
    dwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvnt
    mrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfkaskfgstrgaatvfdafpdqvaiqlndthpalaipelmrifvdieklp
    wskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfpk
    dvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkfq
    nktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkqe
    nklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfvp
    rtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipat
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddvaa
    ldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyeay
    vkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsnes
    nkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xoiA (A:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapyiqavldrnlaen
    isrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrgaatvfdafpdqva
    iqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvek
    llprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavng
    vakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkd
    lsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheyk
    rqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndp
    mvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdg
    anvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkq
    pdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssd
    rtikeyaqniwnvepsdlkislsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xoiB (B:)
    akpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtvr
    dhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldie
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveead
    dwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvnt
    mrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfkaskfgstrgaatvfdafpdqvaiqlndthpalaipelmrifvdieklp
    wskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfpk
    dvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkfq
    nktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkqe
    nklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfvp
    rtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipat
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddvaa
    ldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyeay
    vkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsnes
    nkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xoiB (B:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapyiqavldrnlaen
    isrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrgaatvfdafpdqva
    iqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvek
    llprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavng
    vakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkd
    lsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheyk
    rqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndp
    mvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdg
    anvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkq
    pdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssd
    rtikeyaqniwnvepsdlkislsn