PDB entry 1xog

View 1xog on RCSB PDB site
Description: N9 Tern Influenza neuraminidase complexed with a 2,5-Disubstituted tetrahydrofuran-5-carboxylic acid
Class: hydrolase
Keywords: Influenza, Neuraminidase, tetrahydrofuran inhibitors, HYDROLASE
Deposited on 2004-10-06, released 2005-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xoga_
  • Heterogens: MAN, NAG, ABW

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xogA (A:)
    dfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttirg
    khsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnna
    saviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkegk
    ilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicspv
    ltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpna
    ltddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwtsn
    sivsmcssteflgqwdwpdgakieyfl